DPCstruct | MC4524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 139 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3EWN6 | 1-143 | MSELHLRGISTALAILDESLCAFDRYASGAEDHGVLYHEQNPLSPKEREAILSTIGQIREELREIRDRLGIEPKVQDLASNIWGWCC… |
| A0A3R9NZL4 | 1-137 | MVQPPPLSDTHRRILGVLVRLVETQLLEAEQLLALAAPGPAASQPVVDDLSPAERARLHEIIAAVRAEIGAFHARYGLPSQPVSLRH… |
| A0A0P6WVM8 | 17-157 | None |
| A0A7Y3K7I3 | 2-146 | None |
| A0A3M1WIU6 | 35-170 | None |
| A0A496SKK7 | 2-120 | None |
| A0A7C4BH36 | 1-148 | None |
| A0A535VT31 | 19-161 | None |
| A0A2H6EUL8 | 2-146 | None |
| A0A7V3E830 | 128-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.