DPCstruct | MC4523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 201 ± 13 aa |
| Standard deviation of domain lengths | 13.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D1VSL5 | 346-557 | IELVSSTPLQDEVIFQTPLDLVSDYVAQQILPHNQLDTSFCQQLIVAMAPLLENTHPTADISELYSRFCKECPRSSLLVEYMTPVVR… |
| A0A1S3I7C1 | 1-213 | MVDYSLSTPIHDTSVYQFPLELVSEILQQNEEFLSKIEHENIIVAIAPLLEKNHPTQEICDFFSKHCRNSPRSKIVIELFTPVVHRI… |
| A0A817Z5K1 | 206-415 | None |
| A0A814BFQ7 | 198-407 | None |
| A0A815PD77 | 1-185 | None |
| A0A817FC33 | 209-396 | None |
| A0A819RJY9 | 108-315 | None |
| A0A820JGN9 | 1-182 | None |
| A0A818C3Q8 | 206-415 | None |
| A0A816GP76 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.