DPCstruct | MC45226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 50 ± 3 aa |
| Standard deviation of domain lengths | 3.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 72.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843FLS9 | 3-52 | TVRGVAMNAVDHPHGGGNRQHPGRPTTISRHAPPGRKVGSIAAKRTGKRR |
| A0A2P6V8L9 | 196-247 | WPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRIR |
| A0A199VYB6 | 185-229 | None |
| A0A6A3ATL9 | 195-245 | None |
| A0A643C7Y7 | 286-335 | None |
| A0A803QLF0 | 702-747 | None |
| A0A7N0TIQ1 | 144-188 | None |
| A0A0C9TM09 | 11-57 | None |
| A0A815HNH8 | 36-88 | None |
| A0A7J7N280 | 40-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.