DPCstruct | MC45224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 155 ± 25 aa |
| Standard deviation of domain lengths | 25.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03906 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4S880 | 1-169 | MTVENPNVKNTYGGNGSTTVFPFTFLLNSEDVNNVVVTLTNEDGAETTTTDFVLSLSDKSVLYPKSGAQPLPNGWKITIQRQIPYTQ… |
| A0A843FCR0 | 1-164 | MIPEVQPVKIHYGNNLATKFDFDFYLESEDQLLVEHTNMAGLKTVLEYGVDFSVEEFGNPDGSKITFPLEDSTYSVLAWDDKTGQKE… |
| A0A7U4P4S4 | 18-168 | None |
| A0A7W4QZD3 | 1-140 | None |
| A0A7Z2A9B5 | 1-136 | None |
| A0A381E9B5 | 1-181 | None |
| A0A661F6J1 | 1-162 | None |
| A0A4Q2QZ62 | 1-154 | None |
| A0A7H9VM92 | 6-211 | None |
| A0A5P9EL02 | 6-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.