DPCstruct | MC45221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 315 ± 42 aa |
| Standard deviation of domain lengths | 42.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9JUS3 | 5-304 | VVPRRTNRSIEPSPIDRECMRLWNGSQTKRDFDAFNPAVDTDASEGLKTVCRVCIRVFWTTPHEMLSFENKLRYRPTPPPGMEASHV… |
| A0A4V1XH85 | 500-834 | LPPELQTIGQHQAAKLERTANSSKGWVRKHRSQIQELDILEGWIPTAEDAIKDGIWTQQQEGLFQQGLQDDPYLQYLQSLSVPRGNK… |
| A0A6P8AVQ4 | 1-286 | None |
| A0A366S788 | 9-299 | None |
| A0A370TLG0 | 152-492 | None |
| A0A423X1V6 | 2-417 | None |
| A0A179G652 | 24-369 | None |
| M1W000 | 53-390 | None |
| A0A0E0S8W1 | 17-352 | None |
| A0A194XDK9 | 3-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.