DPCstruct | MC4522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3S4T5 | 304-402 | LPTNFSFKGQNQNTKMKFVAASYDVKGNFLKWQTLEGGVLQLCPDTEIRLNAAYSFGTTYQQNCEISISNILTNFPTPIFYDVYLEY… |
| A0A1S3I499 | 239-346 | KNVLDDTGITQDYYVSPSHANSKLKLIVAKYALNGTFLGLENVTGDTLQICSGNLKMLNAALQFGTTYSLSCQVSMDDLWDENKYPL… |
| A0A819ERX1 | 326-434 | None |
| A0A6H5I284 | 2-109 | None |
| A0A2A6B719 | 390-526 | None |
| A0A0B2VDQ9 | 1-143 | None |
| S9XV09 | 73-211 | None |
| D8LKP2 | 199-335 | None |
| A0A3P7L1R6 | 22-120 | None |
| A0A1X7SP21 | 11-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.