DPCstruct | MC45217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 18.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 71.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1QPC4 | 32-130 | YIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKPILIEPIFAQSI… |
| A0A3P6HHE4 | 16-122 | TQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQI… |
| A0A498KRU4 | 2-103 | None |
| A0A445CGY6 | 88-208 | None |
| A0A6S7N825 | 90-224 | None |
| A0A6J1EYJ0 | 230-353 | None |
| A0A7J9KJ29 | 162-292 | None |
| A0A7J9K7N1 | 16-122 | None |
| A0A2G3BYQ6 | 1-122 | None |
| A0A7J9MWA3 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.