DPCstruct | MC45215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1QJJ9 | 1-101 | MVVRKPAYNFLDELQIEYGEQEDYVVIKLASLFTSTIMNKHLARPNVKLFNTIASEDLIIQEGRVAVVVTNWALVTMNHNTQLFMDP… |
| A0A4D8Z3E0 | 126-214 | MVVRKPAHRFLDELHIAYDEQDDYVVIKHAALFISTIMSKLLASPIVKLFNAVAAEDLIVKPSGVVGVVTNWALMSINHNTQSCMDP… |
| A0A7I4EA76 | 73-169 | None |
| A0A4D9BSE2 | 1-100 | None |
| A0A2P2I4J1 | 84-174 | None |
| A0A1C7M2S2 | 297-392 | None |
| A0A5E4K847 | 12-109 | None |
| A0A6M7ZBC3 | 343-447 | None |
| L2G498 | 70-174 | None |
| A0A7J3LZM4 | 10-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.