DPCstruct | MC45214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 192 ± 29 aa |
| Standard deviation of domain lengths | 29.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9GEV3 | 3-165 | LRDNKGMRYLAELVAAPGTERHALDLVDSIEGMGTDGQPDRRALGHAGEVLDGRARTAYRHRIESLRSDIDDALAGERLETAEALQH… |
| A0A1V6F9Y6 | 40-189 | VGARALRILLSHPHQEIPASRLDEMLRQGSVDLPPASGEGFALVETPIPYSDRRAIREVKARLDYLLKLTTPADPARRREISALRGY… |
| A0A1G9VB52 | 286-460 | None |
| A0A1W9HM33 | 358-578 | None |
| A0A7W8VG13 | 19-160 | None |
| A0A2V6G9I3 | 30-232 | None |
| B5JI03 | 75-261 | None |
| A0A142XDX7 | 222-398 | None |
| A0A2G6MXF9 | 41-248 | None |
| A0A142XE70 | 132-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.