DPCstruct | MC45210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 64 ± 2 aa |
| Standard deviation of domain lengths | 2.27 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 43.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0492 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A359YHI1 | 1-60 | MISSGLVKVNYATTSNVSYAVGLNDLVSVRRFGRLKIVSENGISKSGKYKLTVEVLLSKK |
| A0A380EIX6 | 104-163 | SRTIAKQLIEKKRVKVNHTIVDSADFQLQANDLISIQGFGRAHITDLGGKTKKDKTHITY |
| A0A0K9QXZ5 | 56-118 | None |
| M0XUH0 | 187-250 | None |
| A0A349PV01 | 1-65 | None |
| A0A7K3IFZ5 | 128-188 | None |
| E3CS72 | 162-230 | None |
| A0A845EIT1 | 25-89 | None |
| A0A7N0RFI3 | 264-327 | None |
| A0A5J5NN86 | 148-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.