DPCstruct | MC4521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 203 ± 18 aa |
| Standard deviation of domain lengths | 17.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19431 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183GZH8 | 372-574 | MMPTPQYYISDCLEFDDKQKRDLPQSLTNHQEFLAMNLPSFQNLFLFLVRIPLDLVHEWLKMRRSAQLPSDLLTLQTVMEDCHDCIE… |
| A0A7M7QBG3 | 118-289 | SEEDAYFQEEYEGDQELRRYGMWSPEAKSLNLPSYRAAFVFLSRVPLDVIHEFLRIRLEQKPKQPSPLSVRQLMRELREGLRIACIH… |
| A0A7E4REX8 | 328-540 | None |
| A0A0R4IK63 | 519-718 | None |
| A0A7R9HAM0 | 1-215 | None |
| A0A232F355 | 10-192 | None |
| A0A7R9F3R9 | 614-820 | None |
| A0A2R7WVJ8 | 481-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.