DPCstruct | MC45200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 269 ± 25 aa |
| Standard deviation of domain lengths | 24.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1MF75 | 4-289 | DGLPVNSTVYNVTIPCIRIHSISWAVSAEEVSSADVELITGGESKKLSQISEDLSLYYTEGATVVFDANKTYKVTDDTSVLPSSTLF… |
| A0A229WWD7 | 361-642 | RHVVNRGGELAVNSTVWNLVVPCININSISWARSADDVPRNVTYLVENSTNLSIVNDNPSSYYRPGGAVLFDPNLLWNNSKTKSPWE… |
| A0A420NUA4 | 27-313 | None |
| F0XKH3 | 242-474 | None |
| A0A6A6ZYB4 | 172-469 | None |
| A0A0C9XLP2 | 102-379 | None |
| A0A1B8E206 | 117-372 | None |
| A0A5N5D0I5 | 7-316 | None |
| T0KQ23 | 147-384 | None |
| B0E1B0 | 7-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.