DPCstruct | MC4520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 144 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8GT99 | 12-161 | WERLACLQSPEGYWECTEAVGYLLDVDLNFFAGVFLKEKGIASLGPKAHADILRLVSTLLILQLVRVKKLVKGELLQSLFRLREPPQ… |
| A0A1S3HHC7 | 11-157 | KSDWMQLFKLQNKEYGYWEFSPVLGRLLGISIEYCRSMLADAGVMSLGKKVSQDVYRLLATLLTLTQIVQTVTKSFVSFKEMQATLE… |
| A0A3Q1CLR3 | 549-677 | None |
| A0A670HZL4 | 343-517 | None |
| A0A5N4D8I1 | 201-344 | None |
| A0A671DQH6 | 53-214 | None |
| A0A2I0TXV1 | 4-131 | None |
| A0A3B5R3E0 | 33-149 | None |
| A0A2H6MVH8 | 456-597 | None |
| A0A6I9XNQ8 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.