DPCstruct | MC452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485E355 | 4-102 | CGRLSTCLALLRPTLGEPIPPHLIDRFTVDVLPDVLPEFTPDADLLCDYCLALAQVLLGRSLLPETETTLTGLLCDLVWYFADGLKA… |
| A0A6I2IUA3 | 2-94 | LKVVLQAQLPDHLIKTLTVDLTQPDNYPCALTTDSETLREYCASLIIVLLNQLESPEQQEHIIGILSELVNVLAEDLKAPRFVNSVK… |
| A0A192CIQ7 | 113-211 | None |
| A0A4R6EZQ2 | 1-80 | None |
| A0A2I8NRA6 | 13-98 | None |
| A0A085HC37 | 18-119 | None |
| A0A509D0V0 | 3-98 | None |
| A0A376E5N6 | 78-177 | None |
| A0A827NE84 | 19-117 | None |
| A0A085HBN5 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.