DPCstruct | MC45196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 296 ± 48 aa |
| Standard deviation of domain lengths | 48.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0UAT1 | 19-319 | ADLHNFTTFLSDHQTSQPFRTAVKAFISRYARPQSYSPPLFSALITWQIAFGVADGHEVVMEVVEEDVTTSASVYCDHCRVVGWGGH… |
| A0A7J7HYS3 | 11-306 | KRRRTPKLYGLHTFANPGCPISPSGPFRDNVRGFLRECAEPEGYNVEGMPVWCTFLVQENRGFLVPLYTIEESVKHSLSPFCDHCRS… |
| A0A287NCF5 | 1-256 | None |
| A0A2P5DWI5 | 3-284 | None |
| A0A2P5CA83 | 9-275 | None |
| A0A4P1R8C1 | 572-889 | None |
| A0A4S4DHK0 | 1-446 | None |
| A0A2P2MM24 | 19-321 | None |
| A8J2U0 | 1-387 | None |
| A0A498IB14 | 14-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.