DPCstruct | MC45192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 67 ± 2 aa |
| Standard deviation of domain lengths | 2.33 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4P3J3 | 57-121 | KTILGFRRQEFIHEGLRWFDIRRFYIPVKRTSKYKFYKQLEKEDPRKLLQIPAEAINRGLEPNPR |
| A0A6M1Q5X9 | 219-284 | EKIIDEKNRELCYEGYRWFDVKRHNIHIRHWDGTQYRELPPDDLRRAVQIPFAELEANPEMQPNPR |
| A0A1E9BLT6 | 1-64 | None |
| A0A3C0RW96 | 224-292 | None |
| A0A090W9Z5 | 123-192 | None |
| A0A496MN44 | 80-149 | None |
| A0A353E572 | 148-216 | None |
| A0A0B7IDS7 | 91-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.