DPCstruct | MC4519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 34.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0745 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1E9A3 | 1-100 | MAGAPQHLVGLEHQLQVSRESALLGNYEASLVHFDGAISQVQRYLRTLDDPALRAKWLRAKEDLSGEFQIVKEIVAELSKLRAGSKA… |
| A0A1S3HEL3 | 1-102 | MSANVAEICENTKMGREYALLGNYDTSLVYYQGVIQQIQKLLTSIKDPTRKQKWQQVRQEIATEYEHVKDISSTLASFKADNARSEY… |
| A0A4Y1R4J8 | 17-120 | None |
| A0A7E4S462 | 1-96 | None |
| C1FY36 | 2-93 | None |
| A0A183WFK2 | 4-117 | None |
| A0A6J1X590 | 6-104 | None |
| A0A668SI79 | 4-123 | None |
| A0A8B6DI49 | 9-107 | None |
| A0A7J8QXU4 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.