DPCstruct | MC45184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 191 ± 33 aa |
| Standard deviation of domain lengths | 33.19 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9DVU2 | 11-169 | PPEGLSTETYQQIYEDVLAFVNPRKLNTYPPVYCKASETKLTEFSLDWLATRAGSSNKIKKVYELEGLISDLFAESRDAESRMVPSK… |
| A0A1A9UYQ3 | 3-180 | DRNLGNIYNAVLKFLSSNDDSPSLYTSRECIHIVNWMLNFLKSDIGANNANLNIYSIQYLFYVMKEATCDQGELEKPKTFHITDAHF… |
| J9M1U3 | 153-337 | None |
| J9L6G6 | 85-269 | None |
| A0A7R9J1W8 | 202-403 | None |
| A0A1I8HE62 | 31-219 | None |
| A0A2J7PG07 | 177-382 | None |
| A0A7R9AVN0 | 84-289 | None |
| A0A1D2N0Y9 | 101-340 | None |
| A0A1Y1LN04 | 2-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.