DPCstruct | MC45182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 176 |
|---|---|
| Mean domain length (aa) | 167 ± 30 aa |
| Standard deviation of domain lengths | 30.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.43 |
| Pfam Score | 49.16 |
| Assigned Pfam label(s) | PF00237- PF08118- CL0063- CL0010- PF05316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9UKH8 | 425-597 | MGQKVNPNGIRLGIIQSWCSTWYANSKEFAKNLASDFKVRKFLNKTLSKASVSKLIIERPAKSIRINIYTARPGIVIGKKGEDVEKL… |
| G0QSL5 | 3-216 | KQVKQINKKKKFVADGVFNAELHCFFSKSLQDAGYAGIEVRRTPMKIEIRIKATKPQHVIGLEGKKHKELTYFLQKRFGYANDQLQI… |
| A0A7J6L6G7 | 225-435 | None |
| A0A2T4ZW02 | 23-203 | None |
| A0A212CSX0 | 69-257 | None |
| A0A1Z5SWA1 | 11-204 | None |
| A0A067BG56 | 1-262 | None |
| A0A1I0GFJ3 | 129-299 | None |
| Q1RU61 | 11-158 | None |
| H0XJ72 | 7-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.