DPCstruct | MC45181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 135 |
|---|---|
| Mean domain length (aa) | 165 ± 39 aa |
| Standard deviation of domain lengths | 38.80 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.36 |
| Pfam Score | 89.64 |
| Assigned Pfam label(s) | PF00521- PF03989 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9UKE5 | 425-603 | MKIFQLPETSRGSSGKPIINLLPLEPKEYITAILPVHKHEKEKYVFMATASGIVKKTSLSEFSRPRNSGIIAVNLNTGDKLIGVDLT… |
| A0A4P1ASL5 | 12-194 | AIDPITLPSARGQGEPITGKLTLPPGASIEHMLMESDDRKLLMASDAGYGFVCTFNDLVARNRAGKALITLPDNARVMAPLVIEDDS… |
| A0A060UPS8 | 1-103 | None |
| A0A2Z6IKA7 | 644-830 | None |
| C6SKM4 | 577-753 | None |
| A0A7C3DR42 | 118-242 | None |
| A0A0G1E5A0 | 833-1030 | None |
| A0A7W1HPF2 | 298-491 | None |
| A0A847MHM3 | 55-231 | None |
| A0A212DJI0 | 83-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.