DPCstruct | MC4518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 228 ± 33 aa |
| Standard deviation of domain lengths | 32.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3HC53 | 23-239 | CQHGDRRGTVFINDTRTCRDFQTAQVTWHCYSQVARGYCCDSCSDVYNASDTGCLYGDKAPFCINITRRQCYGKTNQNEPVPDVCCR… |
| A0A3S1HIR9 | 54-279 | HPRDSCPQGDQPGVVHDGKTCEDIVRLTPWACYDDFYRRKCCISCPGISKEATDCPYGDRESWCQTDKMNYPYDCYLNNATCCQSCA… |
| T1ETK8 | 292-547 | None |
| R7UPS0 | 40-235 | None |
| A0A2C9KE57 | 2-218 | None |
| T1FHV2 | 306-529 | None |
| T1FPL5 | 229-450 | None |
| A0A8B6BS24 | 235-493 | None |
| V4AHG6 | 500-704 | None |
| V4BB17 | 388-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.