DPCstruct | MC45179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.36 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0591- CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179RIB2 | 1-82 | MEWQWLDSEAATLHCQSGIGRWGWACHDDEMPKMVLACAGDVPTLEVLAAVTLLQEQAPDVRVRVVNVVDLLALQQSQQHPR |
| A0A365VR51 | 163-246 | RTWNRINVIVAGKQPAPQWLDLDAAIRHCSAGAGIWEWAGNDGDGEPDVVMACAGDVPTLETLAAVDLLRTHLPALRVRVVNVV |
| A0A137QVA6 | 248-340 | None |
| A0A4P9XBG0 | 692-776 | None |
| A0A1V8UTK8 | 982-1080 | None |
| L1KXN4 | 803-902 | None |
| A0A449A3D7 | 351-450 | None |
| A0A137Q9R0 | 231-329 | None |
| T1CT87 | 21-118 | None |
| A0A6M1X776 | 17-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.