DPCstruct | MC45178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 169 ± 25 aa |
| Standard deviation of domain lengths | 25.16 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6C2M1 | 58-191 | SPFDRNVWASLSESEGSLRAINTWDAAFLSAGPFQHTAGTNGGKGELPGVLDTVRENARDAYWHHFGRFGVKPIGAEISGGAKRAYF… |
| A0A4Q6Y7A8 | 93-288 | TPVWTKTKVGDGPAFPGRKPSDTSYRLSESAAWGGMVAAGTVSASEQRVISRMADNEGRLDSVQSYDNQIVTVGAMQKTINPQGTGE… |
| H5WNZ4 | 97-330 | None |
| A0A267T700 | 104-294 | None |
| A0A484HDD2 | 229-392 | None |
| A0A2V7Y550 | 632-807 | None |
| A0A2P6C2G6 | 340-545 | None |
| A0A7S9RGG4 | 1001-1148 | None |
| A0A819C5Y8 | 3-162 | None |
| I4AM44 | 434-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.