DPCstruct | MC45175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 130 ± 24 aa |
| Standard deviation of domain lengths | 23.71 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3SYY2 | 616-746 | MGIEPFMISSSIVGVIAQRLVRRLCVHCRKEYNAGINEKVALKVDDKEDIRIYMPEGCEKCNNTGYKGRIAIYEIMNINRELREIIA… |
| A0A7V5GT64 | 47-172 | MGVEPFLVASSIGGVLAQRLVRRICSACKVEYEASEALLKTMEMEGEKVKLYKGEGCRACSNTGYKGRAGIYEILTMNEEIRALVTA… |
| K1Z207 | 5-138 | None |
| A0A259QBH2 | 8-173 | None |
| A0A4Q7YGX1 | 255-394 | None |
| A0A7W1A533 | 5-121 | None |
| A0A1V5VI85 | 415-547 | None |
| A0A357NII5 | 1-101 | None |
| A0A837Q5Y9 | 8-103 | None |
| R6H5S4 | 338-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.