DPCstruct | MC45172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 150 ± 25 aa |
| Standard deviation of domain lengths | 24.72 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1WG97 | 82-217 | FDYDPHSKVWDEFNRLAKNFHWQEGSQKEKKARNLFRQALVDEFGANYGESDSKLDVLQRLCQKLEIGPMPQSITACKKAINSVYVN… |
| A0A8A3PF00 | 8-108 | IAADFDRYFGNQSVLANWQRLCHDVRIEGADGLRSIRACREALSKVHVNIYELVDANLAGTPVRLFATRAELIRWTVSHKRYFPLKK… |
| A0A0S6XC81 | 13-143 | None |
| A0A317AZF7 | 442-642 | None |
| A0A0J6FPD9 | 22-162 | None |
| A0A1V6S3G0 | 6-145 | None |
| A0A4S2MKJ0 | 128-298 | None |
| A0A1J9QM46 | 157-330 | None |
| A0A3N4I7M8 | 58-253 | None |
| A0A4U0V7F7 | 58-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.