DPCstruct | MC4517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 319 ± 38 aa |
| Standard deviation of domain lengths | 37.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443STB9 | 1-323 | MDQSEEKIVMTPLKREVGLNVLLLERVDVSQMDSNRVIHEAGGNHKGIVINKQAANCVLTAPQASLSFKVFMVNAATNSHTKESRHL… |
| A0A1S3H628 | 3-287 | ANEEEIVMTPSKKGKATRIKIERKRRKELDPTQIAHEAGGQHKGLVVGKDIGEDKDDASPQLQLEFKCWLEDAKSGMHIPEGRLIKF… |
| A0A835G8U6 | 12-296 | None |
| A0A1Y3EKZ1 | 6-233 | None |
| A0A2P8YYH7 | 224-575 | None |
| A0A3P8FIJ7 | 2-293 | None |
| W6U8A0 | 1-311 | None |
| A0A7R9I3Q3 | 47-403 | None |
| A0A0N4UQE9 | 9-315 | None |
| A0A821EH85 | 10-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.