DPCstruct | MC45168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 387 ± 70 aa |
| Standard deviation of domain lengths | 69.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0470 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1W1G0 | 14-433 | HASEGIDLGRAQDVHDINMDVAHGRLGVEEGARRLDEVSGARSEYKVWFLILMYGLASACVAPFGFGGRLIDMPIAFILGCTVGVLQ… |
| A0A0U1PAJ8 | 2-292 | AQPAGRGALAALVASYGLAAGAIATLLHTSWADIAVAGAIGVLIGLIAVAGAARPRLAAAGEAIAALVATLLATLLSAFVVPLAIRS… |
| A0A0H2RFP5 | 160-623 | None |
| A0A087AX78 | 58-379 | None |
| A0A7H4PAP7 | 19-271 | None |
| A0A3N4IGQ3 | 16-445 | None |
| A0A839J6L2 | 2-259 | None |
| A0A7Y5WHC3 | 30-408 | None |
| A0A168J4I4 | 40-383 | None |
| R1DEZ9 | 169-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.