DPCstruct | MC4516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 136 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9IC29 | 13-144 | AEHARGIAALPGEKLAELKQYGAEKLQETMGAFQSALPALRQAGYAMHEFEIELGLTPKIIAHFVPALTHEAAIAQAREALKDNKIG… |
| A0A7C2X665 | 45-171 | KAKDTAADIIDVGKGKLQEGMATVIEETNNIKTILQNSGYCIIDISVTISVPPKAILLFEDTGSGKEKLTELLESEGSTLSKMQTAM… |
| A0A7V6Z1A2 | 31-174 | None |
| A0A837CEQ0 | 5-128 | None |
| A0A7W2RNT1 | 251-376 | None |
| A0A2D5QHQ4 | 9-139 | None |
| A0A2E6ZRE8 | 5-165 | None |
| A0A2E6ZRC5 | 36-147 | None |
| A0A350V3Z1 | 21-169 | None |
| A0A7C7BRB8 | 102-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.