DPCstruct | MC45152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 6.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0123- PF12674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9SND6 | 3-81 | ICQSCGMPMENQELNGKNKDGSVNTEYCVYCYPNGEFNKPDETLEEMVETCVPFLVREGFTEEGAKKHLESTLKSLKRW |
| A0A537HQT5 | 2-79 | QCESCGRPLASREEHGAQNLDNPYCIHCTDMKGKLLPFEKLYGDLVNQSMQTRWMNKEQAEKYSLEEMAKWPAWRDKA |
| C7N2T6 | 65-151 | None |
| A0A3R5ZGD5 | 7-95 | None |
| A0A1V5BZ32 | 75-156 | None |
| A0A1H6LL56 | 204-295 | None |
| A0A3E5B6Q1 | 1-92 | None |
| A0A060UQC6 | 10-94 | None |
| G0JQ66 | 20-93 | None |
| A0A662F6J1 | 12-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.