DPCstruct | MC4515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 143 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5XEV2 | 198-335 | NRFEIRLLADTSLNAEQAKKLPLQSLSLASEPIVHLMLLQWYEWSTHTLTWDSWHNSQILLNYLPEVGSYGLPFVVLADGERVYLGA… |
| A0A7C1JMA7 | 18-171 | AGPATPASEGFAIYLLAEKLSPAEVAQAELGTLKLEDEPILSTEDIVAYVSGAHQITLTPSAMERLGQLKVPVSGAGIPFVVCVDKK… |
| A0A6C0GF61 | 17-174 | None |
| G2FMV0 | 44-201 | None |
| A0A7K3ZPN0 | 27-170 | None |
| A0A522F396 | 5-137 | None |
| A0A832CS36 | 240-381 | None |
| A0A1V5LWP8 | 8-151 | None |
| A0A7X9TCD3 | 20-131 | None |
| A0A3Q9B4F1 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.