DPCstruct | MC45144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E9VWR8 | 5-108 | GAKRSDKVNEIYKSNPKHTLGQTGNRPNAGIEPKNSFELFENSFQSGNKRYSIDSDGNIHQFTHTNKGDNTWHWAGRTGKDQAVDQR… |
| A0A7T8FFU2 | 9-107 | YENPGHHDPNYLPNRQVPFNSSKSVIPSNAEDLFKLSQIDPDDPKTRWTKVGEGKKSVWHRFQSSAADGSGAFHWNGSTDGVDIKGR… |
| A0A514CL93 | 76-172 | None |
| A0A022PBV3 | 46-155 | None |
| A0A7T9H7Y6 | 210-323 | None |
| A0A329VYH8 | 4-94 | None |
| A0A656YNH5 | 316-407 | None |
| D7N1R0 | 498-594 | None |
| A0A379HK48 | 144-248 | None |
| A0A1G4RDN8 | 153-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.