DPCstruct | MC45143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849R3D5 | 4-110 | RAIIRELRIGDEVTVYGSLKEGTLNLEKIELRELNLVVERTPKCNKCGRNMKSAGRSQGYRCKRCGTFSAVKDKVIVERAIETGLYE… |
| A0A2D8BFC8 | 67-169 | GQIATISQQLREGDVVECKGLMAPDLSIHIEFMKIQQVVPHKHRPACPTCDKSMSSMGKDQGLRCKKCGLKMDDRWIETPRLLPVNQ… |
| A0A6V8DSS7 | 41-155 | None |
| A0A7C5RC51 | 1-98 | None |
| A0A843I5W3 | 19-131 | None |
| A0A843BFW0 | 1-76 | None |
| A0A662T466 | 218-335 | None |
| A0A7K4FDI1 | 72-189 | None |
| A0A6V8CZQ2 | 24-125 | None |
| A4YJ31 | 305-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.