DPCstruct | MC4514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2S224 | 73-143 | EIHWEFIRLAMMSVANLVIIPLQDVLGLGNEARMNRPATADGNWGWKFLLEQLTPAVAQTLAELTEIYGRA |
| A0A7C1FJD1 | 3-76 | IAWDLIRLGWASVAQTAITTVQDLLSLGHEHRMNTPGTSGPPNWRWRLLPGALSPAVQARLYELTAIYGRLPVK |
| A0A7V8SXV3 | 15-89 | None |
| A0A6A3AQG9 | 39-130 | None |
| A0A821TLL1 | 3-86 | None |
| A0A819RDP4 | 121-195 | None |
| A0A7W0PYT6 | 70-140 | None |
| A0A357I2N1 | 280-359 | None |
| A0A7Y2CSA2 | 92-173 | None |
| A0A819JYP6 | 54-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.