DPCstruct | MC45139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 475 ± 75 aa |
| Standard deviation of domain lengths | 75.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4EEA5 | 7-449 | ENQERIVIPAIIGCFFILIMICLTDIIPFSVVNEDINNARGILGGVGVEGLSAIFAIVISLTLMAVQFASQEYTHRIMDIHIKSLIF… |
| A0A849QYX2 | 9-366 | YKWMKYKYWIYCIIPTLVVFLILYCAPPDECPENARYILSAISQSLAAILALVFTITLVIAQMTKRYMAMDEIIFRLETKLLMSLFG… |
| A0A1X7E7Y0 | 13-564 | None |
| A0A4Q3PNZ5 | 39-503 | None |
| A0A7C1E4Y6 | 140-570 | None |
| A0A017HSP4 | 121-595 | None |
| A0A3A5BD60 | 1-432 | None |
| A0A4P7RH00 | 242-760 | None |
| A0A447G186 | 34-536 | None |
| A0A7S2W664 | 281-839 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.