DPCstruct | MC45135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 151 ± 23 aa |
| Standard deviation of domain lengths | 22.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146I4Z0 | 244-410 | SVYAQSSASWGDRPVLLLLGLRLGLDNVNPIYYSTIKELFTFPQSVGISGGRPSSSYYFLGVQGDGLIYLDPHHPRPALVLRPPLNI… |
| A0A6G5A6S0 | 8-148 | AAARSWKPLVLFIPLRLGLSEINPVYYCGLKRTFALKQSLGIIGGKPNHALYIIGVVGDDLVFLDPHTTQLAVDLDVECPEDESYHC… |
| B8XVP8 | 318-427 | None |
| A0A7S3JJD3 | 37-179 | None |
| K2G7X1 | 9-149 | None |
| T1L2T0 | 78-215 | None |
| A0A1I8FEE6 | 13-156 | None |
| A0A212CFP9 | 159-287 | None |
| F4Q5K2 | 430-584 | None |
| A0A0C2MMX7 | 17-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.