DPCstruct | MC45130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 6.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09962 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9ZH02 | 1-68 | MDGQKRENVKIGSEVEIVLKADQRAGNFTRGIVAEILTGSASHYRGIKVRLKDGQVGRVQKIYPVFPK |
| T0JMR3 | 20-81 | MDGTKRKDIKSGQSVAIVLKQDQQSGLLTDGIVRDILTKSPSHPHGIKVRLMSGEVGRVKET |
| A0A7S2XS24 | 92-161 | None |
| A0A1I0PS84 | 2-66 | None |
| A0A179HAL3 | 60-131 | None |
| A0A0F7SH69 | 535-603 | None |
| M7XYE1 | 77-146 | None |
| A0A4Q4XBN8 | 4-78 | None |
| A0A7S2CWC2 | 6-90 | None |
| A0A507DN68 | 325-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.