DPCstruct | MC4513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 232 ± 23 aa |
| Standard deviation of domain lengths | 22.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1YH79 | 248-439 | TERELMTIDTITASGDVVITGEFDQTCNQPVFTRWTLNDNEFQVWVYRVMARLINTCQPNPEQHEVVIPMGLDEGVYTYTINETFTG… |
| A0A6L4AA04 | 7-284 | HPRIFIAAILLAVVSTFGVVIVWNARSDNDSQHTFSPTAIPISDFYEPFQMTDVLVETNPMARYPVVVHVHGSLRDGCTRLRTTNVH… |
| W4V4K4 | 9-254 | None |
| A0A2H0PL17 | 6-252 | None |
| A0A496PVA7 | 64-284 | None |
| A0A1V1P8B1 | 1-228 | None |
| H1YFB1 | 4-216 | None |
| A0A3E0NWE0 | 1-237 | None |
| A0A812QQ28 | 183-419 | None |
| T0RXE6 | 1-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.