DPCstruct | MC4512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2361 |
|---|---|
| Mean domain length (aa) | 165 ± 32 aa |
| Standard deviation of domain lengths | 31.54 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.39 |
| Pfam Score | 84.71 |
| Assigned Pfam label(s) | CL0508- CL0466- CL0010- CL0092- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9KXS6 | 3-125 | ATEYVSVLKDGVNIRSGPDTNKEILWTVFKDFPLKVSTRKGKWAQVEDFEGDKGWIFTELINKEKTVIVKVDSANLRGGAGTDHETV… |
| A0A6L4A6V5 | 27-206 | TPSPTPSPEPTAIQPTQTPVDNLVLLARANFRLNVRTGPSTRYAVLGKINPSDVLTITGKLNNGTWLRVQFNDQMGWVSRPLVEVIG… |
| A0A7S4S4E6 | 2-193 | None |
| A0A1D2N5U5 | 47-252 | None |
| A0A2K8XF72 | 344-475 | None |
| H1LCA7 | 98-269 | None |
| H1LDX9 | 512-708 | None |
| A0A397EG98 | 14-208 | None |
| A0A3P3RA12 | 49-219 | None |
| A0A6L9J5U9 | 517-705 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.