DPCstruct | MC45116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 190 ± 35 aa |
| Standard deviation of domain lengths | 35.45 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19841 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1Z735 | 24-228 | LREADVMWSKRVWRVIDLREKMNLPLYYPEEPTVCLMSLFDVLKCALLNDELLAFANPIFDDEFTSPMTKVEVRNMLVSWDSTHQSE… |
| A0A5M4AI80 | 2-124 | GKITYDTIILNPNKDDTWTTECLSKFERKKLIDDIFDAVYAGKLTALDYFTRKKYSIQEVKAMEASGEFTRDKIGKIQFDEQWYWDE… |
| A0A6B5PV95 | 11-215 | None |
| A0A522E5B9 | 22-175 | None |
| A0A1V5P2Q7 | 1-192 | None |
| A0A419S2D2 | 40-300 | None |
| A0A7T9DN87 | 3-193 | None |
| A0A1W9SV00 | 420-585 | None |
| A0A1F3NTM2 | 28-228 | None |
| A0A5M8Q5S5 | 22-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.