DPCstruct | MC45114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9QX87 | 197-299 | AVANSSQIATPDSDTADSYTEPHDPEFVRMITVPYARDGSYFCRHRSLIGGSYFIESKHGSLEFTDYDEALDYMRNMSVARWCRPTD… |
| A0A6S6L3E9 | 1-133 | MSQEAFADRCGFARSYMSRIERGCSNASLDAIEVLAEALSVEPWQLLASDSSEDSAPELLVPYAADGSCFHPGLASTRDGSFGVGDK… |
| X6JNS0 | 133-262 | None |
| A0A7W4I7F9 | 226-354 | None |
| A0A2K1FR56 | 123-243 | None |
| A0A2G2JTG8 | 113-237 | None |
| Q8PAN1 | 1-153 | None |
| A0A2D5F6M4 | 126-241 | None |
| A0A0H2X8U9 | 89-220 | None |
| A0A6J6ZVN9 | 180-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.