DPCstruct | MC45111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K6SAJ1 | 37-109 | PSVRVFNPDDPIEQIQSAVDAAFEINGGDGDKGQFSTARFAFLFTPGTYPVDVPVGYYTHIMGLGLSPDDTVI |
| A0A2C8Z6L4 | 57-132 | FGPNVRIFDPSMPTSQIQAEVDAIRDRQINDEMGTNRYALLFKPGSYGTVENPLMIQVGYYTEVAGLGLNPTDVTI |
| A0A1Q9CK47 | 217-287 | None |
| A0A378MD84 | 1-97 | None |
| A0A1L6LBF6 | 369-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.