DPCstruct | MC45107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 20.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7W0S3 | 10-170 | NPLFDSDALYGKHDDGVDGISSSFAPASRLFKGISINFSGEFSKEGITGLALGPYAVWGGNLAGIFVGAGVVVKDLAGIAIGGVLLG… |
| A0A3D1K4J8 | 76-235 | RVGGVEPSLFYSGTDYVKGVQATLVGPSIGQEILGVQTACVGPTIAKTVHGLQLSGMFNLADDLLGCGLGVANIAKSMAGFQISAVN… |
| A0A7V3RJX0 | 176-303 | None |
| A0A1G3YZR8 | 197-345 | None |
| A0A524K2P4 | 158-297 | None |
| A0A3B9XEP1 | 2-85 | None |
| A0A661NGL0 | 163-303 | None |
| A0A6H9JYS6 | 517-675 | None |
| A0A2E5S2Y6 | 222-360 | None |
| A0A7X6YCF8 | 56-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.