DPCstruct | MC4510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 11.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158KUT3 | 16-103 | ATGGQAGANSSTDACGAVICLAGEMNGHGGGAACSGYIAKYFSIIDWHHGHMDLGPTSRDRMIFLNQCTMEDPAIKQAVNDKYGTQAD |
| A0A709U7X8 | 20-103 | AEKNKVDPNDPCDVYFCMAGMVYGNKSECQPAIKKFFSIQSFKKHHRFNPSKTFRERSKFLGQCSTADPAHVSKIMSKFGRMKG |
| A0A495FRK9 | 153-259 | None |
| A0A840JHL5 | 7-97 | None |
| A0A6D1P0K6 | 21-119 | None |
| A0A3M3K2T6 | 109-205 | None |
| A0A6N8K7N9 | 1-74 | None |
| A0A218MAS7 | 645-755 | None |
| A0A1G5YSP2 | 68-143 | None |
| A0A433ZPX5 | 100-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.