DPCstruct | MC451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4LVW3 | 7-76 | SAYEIIRSHLLELIDEPNAIKNNITAVNYIMDHSFLSRSGIMRVLSKLKSDGYIHLSRGILTDIIDLPEK |
| A0A6I2IS56 | 15-107 | VCHWTTFLLHNLENRDARFIGATKYSQIRATLLIMDSWSPELRERTGVITFVQKRTKISRSVIAEILSALRKGNYIEMDKGKLKSVN… |
| A0A7U9KLZ3 | 73-147 | None |
| A0A383HRH5 | 2-59 | None |
| A0A285KJG5 | 67-163 | None |
| A0A485CUQ9 | 39-131 | None |
| A0A377M4J9 | 69-165 | None |
| K8B088 | 62-154 | None |
| A0A5J6VW04 | 7-85 | None |
| A0A3G7TTX4 | 18-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.