DPCstruct | MC45094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 85 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6W540 | 13-97 | AALVMECFSFLHNAWLFTTSTTSKPECSIYNDEQLHIIMDRVCEICHEMYSHQYPNTRADCRSDCFRSKHFQSCLEHFRPMIPHG |
| A0A183C8K2 | 66-134 | VPSTDDASNRHKYCEIHDNEPLHALMDQICELCHDFFSHVRPNTRVHCRAECFLTATFKKCLQLFIVPN |
| A0A4U5M2Y0 | 18-99 | None |
| A0A0B1TE84 | 98-176 | None |
| A0A2A6BCQ1 | 61-172 | None |
| A0A0B2VTG7 | 61-133 | None |
| A0A0V1BJX0 | 9-102 | None |
| A0A2H2J749 | 1-71 | None |
| Q17662 | 32-132 | None |
| A0A0D8XFZ0 | 3-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.