DPCstruct | MC45076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 334 ± 26 aa |
| Standard deviation of domain lengths | 26.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1TA67 | 5-339 | NRQLLIFIVGIGLVVSVAWTYINFKSNPTEVPMPGVTLSVIPEYKIESGTDLTVWPKGTIFEQGRAAYFYAAKPKITTTPIIKINGM… |
| A0A4U7CA41 | 92-457 | LSIGDRSVLQKYLPAIFAVFLLITAAGGFLVYGAQTAPETTTETQTTGTWSANATFTHAAVVTNGTFTFTEGQRLEDRSLYFTRVSP… |
| A0A7W7M6J7 | 177-494 | None |
| A0A0N8PR89 | 3-295 | None |
| A0A2H5YHV4 | 127-473 | None |
| A0A7M1UUN6 | 18-346 | None |
| A0A7Y3KXC3 | 189-525 | None |
| U1NV93 | 10-375 | None |
| A0A7V7ZKF9 | 155-515 | None |
| A0A5C8ZLY8 | 218-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.