DPCstruct | MC45074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 427 ± 68 aa |
| Standard deviation of domain lengths | 67.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841SRY8 | 47-497 | ERFPNDVYRADLRLAEDRWLRLSLHMLSGRLVGWTWYGGGGEGPSGGTGAVSVTEQRITNKELLDYLKQWGYEPADWEPTGTATGNG… |
| A0A7V3HNK3 | 45-525 | AKARDFWTSRGVNLSGYQEATIFSADNEASVYLQKTVGVDSANALGKSTVPIWFWKVRFFKPLTKEEFIARIEPDGRISAFQHIIPE… |
| A0A846MLT3 | 392-835 | None |
| A0A2V8A421 | 7-335 | None |
| A0A662IH26 | 23-419 | None |
| A0A2E6XXZ8 | 167-682 | None |
| A0A292YU52 | 47-529 | None |
| A0A7X8M7F4 | 54-540 | None |
| A0A2V9BZ73 | 107-655 | None |
| A0A172ZKL1 | 27-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.