DPCstruct | MC45071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 70.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090QXS3 | 221-295 | GFCYRVDMRLRPFGDSGPLVMSYAALEDYYQEQGRDWERYAMIKARVMGRESFTQYQELRQMLRPFVFRRYIDFS |
| F7RKZ2 | 232-302 | VFRVDMRLRPYGESGPLVVSFSGLEDYYQEQGRDWERYAMVKARALGPWSHFSDELHSMLRPFVYRRYIDF |
| A0A2X3FDA0 | 217-292 | None |
| A0A352K108 | 181-250 | None |
| A0A379VJH5 | 1-83 | None |
| A0A2V2L2V1 | 1-67 | None |
| A0A6N3UDR1 | 33-103 | None |
| A0A336NCB7 | 99-175 | None |
| X1XH02 | 14-92 | None |
| A0A2X2W2Y1 | 56-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.