DPCstruct | MC45070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 174 ± 30 aa |
| Standard deviation of domain lengths | 30.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661QGM4 | 8-215 | RWEDPVLGISGEGRVTPLMPGCQVVYTVVDDTGKVIVNNEIADAPDEAKYVGQEHVPLAIDMAPVQPHTAQRKARTCESCHGNSKVA… |
| A0A7V5R6R8 | 198-320 | PGCQDVVTLIDEKGKIEGGFNRFTMAAINPHTTQAKGRDCADCHSSSKTLGLGEGTVLKKDGKWAFIPIDQGVDTLNGRTVGFDNFV… |
| A0A3A4NMT2 | 456-659 | None |
| A0A256WDV7 | 236-407 | None |
| A0A7V7N0X5 | 298-461 | None |
| A0A1G0B1J1 | 92-263 | None |
| A0A1V5YUF2 | 1-189 | None |
| A0A3C0SC46 | 42-225 | None |
| A0A0B0ENU7 | 2-188 | None |
| A0A1F7LT59 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.