DPCstruct | MC45067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.02 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | CL0123- PF03243 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A014P448 | 101-181 | AVGKSAFHILLRTAGRVALEQVSQETGRNTDDIRTGIEALRRRGHVKIDKQGFIIGVAGLSCIPTEHQLSIEGKRLWAWCA |
| D4YL19 | 1-98 | MSELTTQLPERLNNTEETGLDAVLLIPLLRLIVEGGPVTVEQFAAAAGRPVDAVRTGLAAVPDTEYDDQGRIIGQGLTLRPTPHRFT… |
| A0A2W5YCD1 | 190-295 | None |
| A0A072TFB1 | 745-851 | None |
| A0A292YZ31 | 2-103 | None |
| A0A6A7L5Q0 | 6-111 | None |
| A0A653EYZ4 | 119-229 | None |
| L7KT22 | 1-102 | None |
| A0A553FM51 | 1-103 | None |
| A0A7J9WLH9 | 24-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.